Lineage for d6cnza_ (6cnz A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732498Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 2732499Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. 2732568Family a.130.1.0: automated matches [237401] (1 protein)
    not a true family
  6. 2732569Protein automated matches [237402] (7 species)
    not a true protein
  7. 2732577Species Burkholderia thailandensis [TaxId:271848] [237403] (1 PDB entry)
  8. 2732578Domain d6cnza_: 6cnz A: [350261]
    automated match to d4oj7c_
    complexed with edo, no3

Details for d6cnza_

PDB Entry: 6cnz (more details), 2.15 Å

PDB Description: crystal structure of chorismate mutase from burkholderia thailandensis
PDB Compounds: (A:) chorismate mutase

SCOPe Domain Sequences for d6cnza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cnza_ a.130.1.0 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
ddtaltnlvalasqrlalaepvahwkwinrkpisdppreaalltdvekratangvdpaya
rtffddqiaaskqlqnalfatwrathgpegpapdlatstrpqldrltqsliaalarvapl
rdapdcpsrlarsianwktltrydsaqkdalgtalshvcaa

SCOPe Domain Coordinates for d6cnza_:

Click to download the PDB-style file with coordinates for d6cnza_.
(The format of our PDB-style files is described here.)

Timeline for d6cnza_: