Lineage for d1elxa_ (1elx A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27200Fold c.76: Phosphatase/sulphatase [53648] (1 superfamily)
  4. 27201Superfamily c.76.1: Phosphatase/sulphatase [53649] (2 families) (S)
  5. 27202Family c.76.1.1: Alkaline phosphatase [53650] (1 protein)
  6. 27203Protein Alkaline phosphatase [53651] (1 species)
  7. 27204Species Escherichia coli [TaxId:562] [53652] (21 PDB entries)
  8. 27241Domain d1elxa_: 1elx A: [35026]

Details for d1elxa_

PDB Entry: 1elx (more details), 2.6 Å

PDB Description: e. coli alkaline phosphatase mutant (s102a)

SCOP Domain Sequences for d1elxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1elxa_ c.76.1.1 (A:) Alkaline phosphatase {Escherichia coli}
tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdaaasatawstgvktyngal
gvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpg
nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
aygphaanvvgltdqtdlfytmkaalglk

SCOP Domain Coordinates for d1elxa_:

Click to download the PDB-style file with coordinates for d1elxa_.
(The format of our PDB-style files is described here.)

Timeline for d1elxa_: