SCOPe 2.08: Domain d6cexa1: 6cex A:11-326

Lineage for d6cexa1 (6cex A:11-326)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (58 species)
   not a true protein

7. Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [327808] (18 PDB entries)

8. Domain d6cexa1: 6cex A:11-326 [350258]
   Other proteins in same PDB: d6cexa2, d6cexb_, d6cexc2, d6cexd_, d6cexe2, d6cexf_
   automated match to d4xkga_
   complexed with gol, nag, nhe, so4

Details for d6cexa1

PDB Entry: 6cex, 2.57 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin in complex with small molecule n-cyclohexyltaurine

PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6cexa1:

Sequence; same for both SEQRES and ATOM records:

>d6cexa1 b.19.1.0 (A:11-326) automated matches {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal
lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv
tqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstnqe
qtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsngn
liaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpkyvk
qntlklatgmrnvpek

Timeline for d6cexa1:

• d6cexa1 first appeared in SCOPe 2.07