Lineage for d6cnzf_ (6cnz F:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. Family a.130.1.0: automated matches [237401] (1 protein)
    not a true family
  6. Protein automated matches [237402] (7 species)
    not a true protein
  7. Species Burkholderia thailandensis [TaxId:57975] [350232] (1 PDB entry)
  8. Domain d6cnzf_: 6cnz F: [350233]
    automated match to d4oj7c_
    complexed with edo, no3

Details for d6cnzf_

PDB Entry: 6cnz (more details), 2.15 Å

PDB Description: crystal structure of chorismate mutase from burkholderia thailandensis
PDB Compounds: (F:) chorismate mutase

SCOPe Domain Sequences for d6cnzf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cnzf_ a.130.1.0 (F:) automated matches {Burkholderia thailandensis [TaxId: 57975]}
dtaltnlvalasqrlalaepvahwkwinrkpisdppreaalltdvekratangvdpayar
tffddqiaaskqlqnalfatwrathgpegpapdlatstrpqldrltqsliaalarvaplr
dapdcpsrlarsianwktltrydsaqkdalgtalshvc

SCOPe Domain Coordinates for d6cnzf_ are not available.

Timeline for d6cnzf_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6cnza_, d6cnzb_, d6cnzc_, d6cnzd_, d6cnze_