Lineage for d6cj9a_ (6cj9 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778888Protein automated matches [190035] (28 species)
    not a true protein
  7. 2779025Species Dioclea lasiophylla [TaxId:1457464] [350227] (1 PDB entry)
  8. 2779026Domain d6cj9a_: 6cj9 A: [350228]
    automated match to d2jdza_
    complexed with ca, mn, xmm

Details for d6cj9a_

PDB Entry: 6cj9 (more details), 1.7 Å

PDB Description: crystal structure of lectin from dioclea lasiophylla seeds (dlyl) complexed with x-man
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d6cj9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cj9a_ b.29.1.1 (A:) automated matches {Dioclea lasiophylla [TaxId: 1457464]}
adtivaveldsypntdigdpsyphigidiksirskstarwnmqtgkvgtahisynsvakr
lsavvsysgtssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsi
adanslhfsfsqfsqnpkdlilqgdattdsdgnlqltrvssdgspqgssvgralfyapvh
iweksavvasfdatftflikspdrdpadgitffiantdtsipsgsggrllglfpdan

SCOPe Domain Coordinates for d6cj9a_:

Click to download the PDB-style file with coordinates for d6cj9a_.
(The format of our PDB-style files is described here.)

Timeline for d6cj9a_: