![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.1: Legume lectins [49900] (5 proteins) |
![]() | Protein automated matches [190035] (28 species) not a true protein |
![]() | Species Dioclea lasiophylla [TaxId:1457464] [350227] (1 PDB entry) |
![]() | Domain d6cj9a_: 6cj9 A: [350228] automated match to d2jdza_ complexed with ca, mn, xmm |
PDB Entry: 6cj9 (more details), 1.7 Å
SCOPe Domain Sequences for d6cj9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cj9a_ b.29.1.1 (A:) automated matches {Dioclea lasiophylla [TaxId: 1457464]} adtivaveldsypntdigdpsyphigidiksirskstarwnmqtgkvgtahisynsvakr lsavvsysgtssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsi adanslhfsfsqfsqnpkdlilqgdattdsdgnlqltrvssdgspqgssvgralfyapvh iweksavvasfdatftflikspdrdpadgitffiantdtsipsgsggrllglfpdan
Timeline for d6cj9a_: