Lineage for d6chqa1 (6chq A:1-159)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2442769Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2442887Protein Phosphopantetheine adenylyltransferase [52398] (7 species)
  7. 3050002Species Escherichia coli [TaxId:83333] [350064] (11 PDB entries)
  8. 3050149Domain d6chqa1: 6chq A:1-159 [350211]
    Other proteins in same PDB: d6chqa2
    automated match to d1gn8a_
    complexed with dms, f0v, pg4, so4

Details for d6chqa1

PDB Entry: 6chq (more details), 1.79 Å

PDB Description: phosphopantetheine adenylyltransferase (coad) in complex with 2- benzyl-n-(3-chloro-4-methylphenyl)-5-methyl-[1,2,4]triazolo[1,5- a]pyrimidin-7-amine
PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d6chqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6chqa1 c.26.1.3 (A:1-159) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 83333]}
mqkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqata
hlgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmp
skewsfissslvkevarhqgdvthflpenvhqalmakla

SCOPe Domain Coordinates for d6chqa1:

Click to download the PDB-style file with coordinates for d6chqa1.
(The format of our PDB-style files is described here.)

Timeline for d6chqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6chqa2
View in 3D
Domains from other chains:
(mouse over for more information)
d6chqb_