Lineage for d1ajdb_ (1ajd B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1873372Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 1873373Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 1873374Family c.76.1.1: Alkaline phosphatase [53650] (2 proteins)
    common fold is decorated with several large insertions
    automatically mapped to Pfam PF00245
  6. 1873375Protein Alkaline phosphatase [53651] (4 species)
  7. 1873383Species Escherichia coli [TaxId:562] [53652] (42 PDB entries)
  8. 1873439Domain d1ajdb_: 1ajd B: [35021]
    complexed with mg, zn; mutant

Details for d1ajdb_

PDB Entry: 1ajd (more details), 2.5 Å

PDB Description: three-dimensional structure of the d153g mutant of e. coli alkaline phosphatase: a mutant with weaker magnesium binding and increased catalytic activity
PDB Compounds: (B:) alkaline phosphatase intermediate II of holo enzyme

SCOPe Domain Sequences for d1ajdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ajdb_ c.76.1.1 (B:) Alkaline phosphatase {Escherichia coli [TaxId: 562]}
tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
gvdihekdhptilemakaaglatgnvstaelqgatpaalvahvtsrkcygpsatsekcpg
nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaeargyqlvsda
aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
aygphaanvvgltdqtdlfytmkaalglk

SCOPe Domain Coordinates for d1ajdb_:

Click to download the PDB-style file with coordinates for d1ajdb_.
(The format of our PDB-style files is described here.)

Timeline for d1ajdb_: