Lineage for d6cn2a_ (6cn2 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.143: SAICAR synthase-like [56103] (1 superfamily)
    consists of two alpha+beta subdomains
  4. Superfamily d.143.1: SAICAR synthase-like [56104] (4 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies
  5. Family d.143.1.0: automated matches [191445] (1 protein)
    not a true family
  6. Protein automated matches [190664] (8 species)
    not a true protein
  7. Species Zebrafish (Danio rerio) [TaxId:7955] [319711] (3 PDB entries)
  8. Domain d6cn2a_: 6cn2 A: [350190]
    automated match to d5e3sa_
    complexed with atp, ca

Details for d6cn2a_

PDB Entry: 6cn2 (more details), 3.1 Å

PDB Description: crystal structure of zebrafish phosphatidylinositol-4-phosphate 5- kinase alpha isoform d236n with bound atp/ca2+
PDB Compounds: (A:) Phosphatidylinositol-4-phosphate 5-kinase, type I, alpha

SCOPe Domain Sequences for d6cn2a_:

Sequence, based on SEQRES records: (download)

>d6cn2a_ d.143.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
tssalkgaiqlgithsvgslsqkperdvlmqdfevvesiffpsqgssstpghhhgdfkfk
tyapiafryfremfgirpddylyslcneplielsnpgasgslfyvssddefiiktvqhke
aeflqtllpgyfmnlnqnmrtllpkfyglycvqadgknirivvmnnllpravpmhlkfnl
kgstykrraspkerskgvptykdldfmqdmpegillendhytalsrtmqrdcrvlqsfki
mdysllvgihilhrageeastavpdtqkkgqgqkplyctaiesiqgesksktspqpyesm
ggipafnskgerllvfigiidilqsyrlvkklehswkallhdgdtvsvhrpsfyadrfqk
fmcstvfrk

Sequence, based on observed residues (ATOM records): (download)

>d6cn2a_ d.143.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
tssalkgaiqlgithsvgslsqkperdvlmqdfevvesiffpsqgssstpghhhgdfkfk
tyapiafryfremfgirpddylyslcneplielsslfyvssddefiiktvqhkeaeflqt
llpgyfmnlnqnmrtllpkfyglycvqadgknirivvmnnllpravpmhlkfnlkgstyk
rraspkerskgvptykdldfmqdmpegillendhytalsrtmqrdcrvlqsfkimdysll
vgihilhmggipafnskgerllvfigiidilqsyrtvsvhrpsfyadrfqkfmcstvfrk

SCOPe Domain Coordinates for d6cn2a_ are not available.

Timeline for d6cn2a_: