Lineage for d6c86b2 (6c86 B:194-545)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967616Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2967617Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2968016Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2968017Protein automated matches [226887] (24 species)
    not a true protein
  7. 2968043Species Cryptosporidium parvum [TaxId:353152] [326196] (5 PDB entries)
  8. 2968057Domain d6c86b2: 6c86 B:194-545 [350168]
    Other proteins in same PDB: d6c86a1, d6c86a3, d6c86b1, d6c86b3
    automated match to d5elna2
    protein/RNA complex; complexed with cl, edo, kaa, na, so4

Details for d6c86b2

PDB Entry: 6c86 (more details), 2.15 Å

PDB Description: crystal structure of lysyl-trna synthetase from cryptosporidium parvum complexed with l-lysylsulfamoyl adenosine
PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6c86b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c86b2 d.104.1.0 (B:194-545) automated matches {Cryptosporidium parvum [TaxId: 353152]}
dqevryrqryldlmlneesrkvfklrsraikyirnyfdrlgflevetpmlnmiyggaaar
pfityhneletqlymriapelylkqlivggldkvyeigknfrnegidlthnpeftamefy
mayadyydlmdlteelisglvleihgslkipyhpdgpegkcieidfttpwkrfsfveeie
sglgeklkrpldsqenidfmvemcekheielphprtaaklldklaghfvetkctnpsfii
dhpqtmsplakwhrekpemterfelfvlgkelcnaytelneplqqrkffeqqadakasgd
veacpidetfclalehglpptggwglgidrlimfladknnikevilfpamrn

SCOPe Domain Coordinates for d6c86b2:

Click to download the PDB-style file with coordinates for d6c86b2.
(The format of our PDB-style files is described here.)

Timeline for d6c86b2: