SCOPe 2.08: Domain d6c86b2: 6c86 B:194-545

Lineage for d6c86b2 (6c86 B:194-545)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.0: automated matches [227172] (1 protein)
   not a true family

6. Protein automated matches [226887] (24 species)
   not a true protein

7. Species Cryptosporidium parvum [TaxId:353152] [326196] (5 PDB entries)

8. Domain d6c86b2: 6c86 B:194-545 [350168]
   Other proteins in same PDB: d6c86a1, d6c86a3, d6c86b1, d6c86b3
   automated match to d5elna2
   protein/RNA complex; complexed with cl, edo, kaa, na, so4

Details for d6c86b2

PDB Entry: 6c86, 2.15 Å

PDB Description: crystal structure of lysyl-trna synthetase from cryptosporidium parvum complexed with l-lysylsulfamoyl adenosine

PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6c86b2:

Sequence; same for both SEQRES and ATOM records:

>d6c86b2 d.104.1.0 (B:194-545) automated matches {Cryptosporidium parvum [TaxId: 353152]}
dqevryrqryldlmlneesrkvfklrsraikyirnyfdrlgflevetpmlnmiyggaaar
pfityhneletqlymriapelylkqlivggldkvyeigknfrnegidlthnpeftamefy
mayadyydlmdlteelisglvleihgslkipyhpdgpegkcieidfttpwkrfsfveeie
sglgeklkrpldsqenidfmvemcekheielphprtaaklldklaghfvetkctnpsfii
dhpqtmsplakwhrekpemterfelfvlgkelcnaytelneplqqrkffeqqadakasgd
veacpidetfclalehglpptggwglgidrlimfladknnikevilfpamrn

Timeline for d6c86b2:

• d6c86b2 first appeared in SCOPe 2.07