Lineage for d1alha_ (1alh A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. Family c.76.1.1: Alkaline phosphatase [53650] (2 proteins)
    common fold is decorated with several large insertions
    automatically mapped to Pfam PF00245
  6. Protein Alkaline phosphatase [53651] (4 species)
  7. Species Escherichia coli [TaxId:562] [53652] (44 PDB entries)
  8. Domain d1alha_: 1alh A: [35016]
    complexed with po4, so4, zn; mutant

Details for d1alha_

PDB Entry: 1alh (more details), 2.5 Å

PDB Description: kinetics and crystal structure of a mutant e. coli alkaline phosphatase (asp-369-->asn): a mechanism involving one zinc per active site
PDB Compounds: (A:) alkaline phosphatase

SCOPe Domain Sequences for d1alha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1alha_ c.76.1.1 (A:) Alkaline phosphatase {Escherichia coli [TaxId: 562]}
mpvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaarn
yaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngalgvd
ihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpgnal
ekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaeargyqlvsdaasl
nsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmt
dkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkegntl
vivtanhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaayg
phaanvvgltdqtdlfytmkaalglk

SCOPe Domain Coordinates for d1alha_ are not available.

Timeline for d1alha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1alhb_