Lineage for d6cexb_ (6cex B:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645407Protein Influenza hemagglutinin (stalk) [58066] (17 species)
    trimer
  7. 2645510Species Influenza A virus (strain a/northern territory/60/1968 h3n2) [TaxId:384505] [327816] (3 PDB entries)
  8. 2645517Domain d6cexb_: 6cex B: [350159]
    Other proteins in same PDB: d6cexa1, d6cexa2, d6cexc1, d6cexc2, d6cexe1, d6cexe2
    automated match to d1qfub_
    complexed with bma, gol, man, nag, nhe, so4

Details for d6cexb_

PDB Entry: 6cex (more details), 2.57 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin in complex with small molecule n-cyclohexyltaurine
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d6cexb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cexb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus (strain a/northern territory/60/1968 h3n2) [TaxId: 384505]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrf

SCOPe Domain Coordinates for d6cexb_:

Click to download the PDB-style file with coordinates for d6cexb_.
(The format of our PDB-style files is described here.)

Timeline for d6cexb_: