SCOPe 2.08: Domain d6cexb_: 6cex B:

Lineage for d6cexb_ (6cex B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (22 species)
   trimer

7. Species Influenza A virus (strain a/northern territory/60/1968 h3n2) [TaxId:384505] [327816] (3 PDB entries)

8. Domain d6cexb_: 6cex B: [350159]
   Other proteins in same PDB: d6cexa1, d6cexa2, d6cexc1, d6cexc2, d6cexe1, d6cexe2
   automated match to d1qfub_
   complexed with gol, nag, nhe, so4

Details for d6cexb_

PDB Entry: 6cex, 2.57 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin in complex with small molecule n-cyclohexyltaurine

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d6cexb_:

Sequence; same for both SEQRES and ATOM records:

>d6cexb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus (strain a/northern territory/60/1968 h3n2) [TaxId: 384505]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrf

Timeline for d6cexb_:

• d6cexb_ first appeared in SCOPe 2.07