SCOPe 2.08: Domain d6chmb1: 6chm B:1-159

Lineage for d6chmb1 (6chm B:1-159)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)

6. Protein Phosphopantetheine adenylyltransferase [52398] (7 species)

7. Species Escherichia coli [TaxId:83333] [350064] (18 PDB entries)

8. Domain d6chmb1: 6chm B:1-159 [350145]
   Other proteins in same PDB: d6chmb2
   automated match to d1gn8a_
   complexed with f1v, so4

Details for d6chmb1

PDB Entry: 6chm, 2.28 Å

PDB Description: phosphopantetheine adenylyltransferase (coad) in complex with n-(2-(5- methoxy-1h-indol-3-yl)ethyl)pivalamide

PDB Compounds: (B:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d6chmb1:

Sequence; same for both SEQRES and ATOM records:

>d6chmb1 c.26.1.3 (B:1-159) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 83333]}
mqkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqata
hlgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmp
skewsfissslvkevarhqgdvthflpenvhqalmakla

Timeline for d6chmb1:

• d6chmb1 first appeared in SCOPe 2.07