Lineage for d6chlb_ (6chl B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2468637Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2468755Protein Phosphopantetheine adenylyltransferase [52398] (7 species)
  7. 2468776Species Escherichia coli [TaxId:83333] [350064] (11 PDB entries)
  8. 2468793Domain d6chlb_: 6chl B: [350144]
    Other proteins in same PDB: d6chla2
    automated match to d1gn8a_
    complexed with dms, exj, so4

Details for d6chlb_

PDB Entry: 6chl (more details), 2.2 Å

PDB Description: phosphopantetheine adenylyltransferase (coad) in complex with (r)-3- (3-chlorophenyl)-3-((5-methyl-7-oxo-4,7-dihydro-[1,2,4]triazolo[1,5- a]pyrimidin-2-yl)amino)propanenitrile
PDB Compounds: (B:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d6chlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6chlb_ c.26.1.3 (B:) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 83333]}
kraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatahl
gnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmpsk
ewsfissslvkevarhqgdvthflpenvhqalmakla

SCOPe Domain Coordinates for d6chlb_:

Click to download the PDB-style file with coordinates for d6chlb_.
(The format of our PDB-style files is described here.)

Timeline for d6chlb_: