SCOPe 2.07: Domain d6c9eb_: 6c9e B:

Lineage for d6c9eb_ (6c9e B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (160 species)
   not a true protein

7. Species Legionella pneumophila [TaxId:272624] [350056] (4 PDB entries)

8. Domain d6c9eb_: 6c9e B: [350132]
   automated match to d1t3ia_
   complexed with edo, zn

Details for d6c9eb_

PDB Entry: 6c9e, 1.55 Å

PDB Description: crystal structure of cysteine desulfurase from legionella pneumophila philadelphia 1

PDB Compounds: (B:) Cysteine desulfurase

SCOPe Domain Sequences for d6c9eb_:

Sequence; same for both SEQRES and ATOM records:

>d6c9eb_ c.67.1.0 (B:) automated matches {Legionella pneumophila [TaxId: 272624]}
tsfdvnkirkdfpvlhqkineydlvyfdnaattqkpkavidaiaqfyekdnsnvhrgvha
lsvratemyeaarakvkrfinarsprecifvrgtteainlvaqslvaprilpdeeilith
mehhsnivpwqmvckkmgcklqvapislngevileeferklnentkmvainyasnslgti
npvktmikmahevgakvlldgaqatahlivdvqdldcdfyafsghkmygptgigvlwgke
ellnsmtpyqgggeminsvsfeateyaaiphkfeagtpniagaiglaaaidyiwsldlda
iaeyetqllnyatkaieavkgyniigtaankvpiisfvhgkihahdigtildsegiairs
ghhctmplmdfydvaatsrismsfyntfkeidycmealqrvkevfa

Timeline for d6c9eb_:

• d6c9eb_ is new in SCOPe 2.07-stable
  
• d6c9eb_ appears in the current release, SCOPe 2.08