Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.0: automated matches [227172] (1 protein) not a true family |
Protein automated matches [226887] (24 species) not a true protein |
Species Cryptosporidium parvum [TaxId:353152] [326196] (5 PDB entries) |
Domain d6c86a2: 6c86 A:194-545 [350128] Other proteins in same PDB: d6c86a1, d6c86a3, d6c86b1, d6c86b3 automated match to d5elna2 protein/RNA complex; complexed with cl, edo, kaa, na, so4 |
PDB Entry: 6c86 (more details), 2.15 Å
SCOPe Domain Sequences for d6c86a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6c86a2 d.104.1.0 (A:194-545) automated matches {Cryptosporidium parvum [TaxId: 353152]} dqevryrqryldlmlneesrkvfklrsraikyirnyfdrlgflevetpmlnmiyggaaar pfityhneletqlymriapelylkqlivggldkvyeigknfrnegidlthnpeftamefy mayadyydlmdlteelisglvleihgslkipyhpdgpegkcieidfttpwkrfsfveeie sglgeklkrpldsqenidfmvemcekheielphprtaaklldklaghfvetkctnpsfii dhpqtmsplakwhrekpemterfelfvlgkelcnaytelneplqqrkffeqqadakasgd veacpidetfclalehglpptggwglgidrlimfladknnikevilfpamrn
Timeline for d6c86a2: