Lineage for d6cb5a_ (6cb5 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2526467Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2526468Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2526662Family d.80.1.3: MIF-related [55339] (3 proteins)
    automatically mapped to Pfam PF01187
  6. 2526679Protein Microphage migration inhibition factor (MIF) [55340] (8 species)
    synonym: glycosylation-inhibiting factor (GIF)
  7. 2526685Species Human (Homo sapiens) [TaxId:9606] [55341] (94 PDB entries)
  8. 3050062Domain d6cb5a_: 6cb5 A: [350124]
    automated match to d1ljta_
    complexed with ev7, so4

Details for d6cb5a_

PDB Entry: 6cb5 (more details), 1.78 Å

PDB Description: macrophage migration inhibitory factor in complex with a pyrazole inhibitor (8g)
PDB Compounds: (A:) macrophage migration inhibitory factor

SCOPe Domain Sequences for d6cb5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cb5a_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens) [TaxId: 9606]}
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

SCOPe Domain Coordinates for d6cb5a_:

Click to download the PDB-style file with coordinates for d6cb5a_.
(The format of our PDB-style files is described here.)

Timeline for d6cb5a_:

  • d6cb5a_ is new in SCOPe 2.07-stable