SCOPe 2.08: Domain d6cclb1: 6ccl B:2-159

Lineage for d6cclb1 (6ccl B:2-159)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)

6. Protein Phosphopantetheine adenylyltransferase [52398] (7 species)

7. Species Escherichia coli [TaxId:83333] [350064] (18 PDB entries)

8. Domain d6cclb1: 6ccl B:2-159 [350120]
   Other proteins in same PDB: d6ccla2, d6cclb2
   automated match to d1gn8a_
   complexed with dms, exg, so4

Details for d6cclb1

PDB Entry: 6ccl, 1.77 Å

PDB Description: crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 1-benzyl-1h-imidazo[4,5-b]pyridine

PDB Compounds: (B:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d6cclb1:

Sequence; same for both SEQRES and ATOM records:

>d6cclb1 c.26.1.3 (B:2-159) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 83333]}
qkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatah
lgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmps
kewsfissslvkevarhqgdvthflpenvhqalmakla

Timeline for d6cclb1:

• d6cclb1 first appeared in SCOPe 2.07