SCOPe 2.08: Domain d6c8ra1: 6c8r A:17-371

Lineage for d6c8ra1 (6c8r A:17-371)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (87 species)
   not a true protein

7. Species Catharanthus roseus [TaxId:4058] [350051] (2 PDB entries)

8. Domain d6c8ra1: 6c8r A:17-371 [350118]
   Other proteins in same PDB: d6c8ra2
   automated match to d1m6ex_
   complexed with eqv, sah

Details for d6c8ra1

PDB Entry: 6c8r, 1.95 Å

PDB Description: loganic acid o-methyltransferase complexed with sah and loganic acid

PDB Compounds: (A:) Loganic acid O-methyltransferase

SCOPe Domain Sequences for d6c8ra1:

Sequence; same for both SEQRES and ATOM records:

>d6c8ra1 c.66.1.0 (A:17-371) automated matches {Catharanthus roseus [TaxId: 4058]}
veahpmkggddshsysqnscyqkgvidaakaviveavnekldlennpifdpikpfriadf
gcstgpntfhamqnivesvetkykslqktpefhvffndhvnndfnvlfrslppnreffaa
gvpgsfytrvfpknsihfahcsyalhwlskvpkeiqdknslaynkgrihytgtekhvvka
yfgqfqrdfegflkaraqeivvgglmviqipglpsgevlfsrtgagllhfllgtslmelv
nkgiineesvdsfnlpqyhpsvedlemviemndcftiervgtlphpmknlpfdvqrtslq
vraimeciltehfgenildplfeiytknlqenfhvfdkeirkdadlylvlkrkgn

Timeline for d6c8ra1:

• d6c8ra1 first appeared in SCOPe 2.07