SCOPe 2.07: Domain d6chda1: 6chd A:71-221

Lineage for d6chda1 (6chd A:71-221)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (50 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225402] (14 PDB entries)

8. Domain d6chda1: 6chd A:71-221 [350116]
   Other proteins in same PDB: d6chda2, d6chdb2
   automated match to d3bjua1
   protein/RNA complex; complexed with edo, gol, kaa, so4

Details for d6chda1

PDB Entry: 6chd, 2.5 Å

PDB Description: crystal structure of human lysyl-trna synthetase complexed with l- lysylsulfamoyl adenosine

PDB Compounds: (A:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6chda1:

Sequence; same for both SEQRES and ATOM records:

>d6chda1 b.40.4.0 (A:71-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvag
rihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgk
tkkgelsiipyeitllspclhmlphlhfglk

Timeline for d6chda1:

• d6chda1 is new in SCOPe 2.07-stable
  
• d6chda1 appears in the current release, SCOPe 2.08