Lineage for d1ajab_ (1aja B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27200Fold c.76: Phosphatase/sulphatase [53648] (1 superfamily)
  4. 27201Superfamily c.76.1: Phosphatase/sulphatase [53649] (2 families) (S)
  5. 27202Family c.76.1.1: Alkaline phosphatase [53650] (1 protein)
  6. 27203Protein Alkaline phosphatase [53651] (1 species)
  7. 27204Species Escherichia coli [TaxId:562] [53652] (21 PDB entries)
  8. 27228Domain d1ajab_: 1aja B: [35011]

Details for d1ajab_

PDB Entry: 1aja (more details), 2.5 Å

PDB Description: three-dimensional structure of the d153g mutant of e. coli alkaline phosphatase: a mutant with weaker magnesium binding and increased catalytic activity

SCOP Domain Sequences for d1ajab_:

Sequence, based on SEQRES records: (download)

>d1ajab_ c.76.1.1 (B:) Alkaline phosphatase {Escherichia coli}
tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
gvdihekdhptilemakaaglatgnvstaelqgatpaalvahvtsrkcygpsatsekcpg
nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaeargyqlvsda
aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
aygphaanvvgltdqtdlfytmkaalglk

Sequence, based on observed residues (ATOM records): (download)

>d1ajab_ c.76.1.1 (B:) Alkaline phosphatase {Escherichia coli}
tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
gvdihekdhptilemakaaglatgnvstaelqgatpaalvahvtsrkcygpsatsekcpg
nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaeargyqlvsda
aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
qmtdkaiellsknekgfflqvegasanpcgqigetvdldeavqralefakkegntlvivt
adhahasqivapdtkapgltqalntkdgavmvmsyehtgsqlriaaygphaanvvgltdq
tdlfytmkaalglk

SCOP Domain Coordinates for d1ajab_:

Click to download the PDB-style file with coordinates for d1ajab_.
(The format of our PDB-style files is described here.)

Timeline for d1ajab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ajaa_