Lineage for d6ccnb1 (6ccn B:2-159)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860373Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2860491Protein Phosphopantetheine adenylyltransferase [52398] (7 species)
  7. 2860512Species Escherichia coli [TaxId:83333] [350064] (18 PDB entries)
  8. 2860528Domain d6ccnb1: 6ccn B:2-159 [350107]
    Other proteins in same PDB: d6ccnb2
    automated match to d1gn8a_
    complexed with exs, so4

Details for d6ccnb1

PDB Entry: 6ccn (more details), 1.87 Å

PDB Description: crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with (r)-2,4-dihydroxy-n-(2-(4-hydroxy-1h- benzo[d]imidazol-2-yl)ethyl)-3,3-dimethylbutanamide
PDB Compounds: (B:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d6ccnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ccnb1 c.26.1.3 (B:2-159) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 83333]}
qkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatah
lgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmps
kewsfissslvkevarhqgdvthflpenvhqalmakla

SCOPe Domain Coordinates for d6ccnb1:

Click to download the PDB-style file with coordinates for d6ccnb1.
(The format of our PDB-style files is described here.)

Timeline for d6ccnb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ccnb2
View in 3D
Domains from other chains:
(mouse over for more information)
d6ccna_