Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) |
Protein Phosphopantetheine adenylyltransferase [52398] (7 species) |
Species Escherichia coli [TaxId:83333] [350064] (11 PDB entries) |
Domain d6ccoa1: 6cco A:1-159 [350081] Other proteins in same PDB: d6ccoa2 automated match to d1gn8a_ complexed with exv, so4 |
PDB Entry: 6cco (more details), 1.82 Å
SCOPe Domain Sequences for d6ccoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ccoa1 c.26.1.3 (A:1-159) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 83333]} mqkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqata hlgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmp skewsfissslvkevarhqgdvthflpenvhqalmakla
Timeline for d6ccoa1: