Lineage for d6c12a2 (6c12 A:236-355)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001255Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 3001256Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 3001257Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 3001328Protein Succinate dehydogenase [82818] (3 species)
  7. 3001344Species Escherichia coli [TaxId:83334] [349937] (1 PDB entry)
  8. 3001345Domain d6c12a2: 6c12 A:236-355 [350074]
    Other proteins in same PDB: d6c12a1, d6c12a3, d6c12b1, d6c12b3, d6c12c_, d6c12d_
    automated match to d1neka3
    complexed with fad, na

Details for d6c12a2

PDB Entry: 6c12 (more details), 2.15 Å

PDB Description: sdha-sdhe complex
PDB Compounds: (A:) Succinate dehydrogenase flavoprotein subunit

SCOPe Domain Sequences for d6c12a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c12a2 d.168.1.1 (A:236-355) Succinate dehydogenase {Escherichia coli [TaxId: 83334]}
memwqfhptgiagagvlvtegcrgeggyllnkhgerfmeryapnakdlagrdvvarsimi
eiregrgcdgpwgphaklkldhlgkevlesrlpgilelsrtfahvdpvkepipviptchy

SCOPe Domain Coordinates for d6c12a2:

Click to download the PDB-style file with coordinates for d6c12a2.
(The format of our PDB-style files is described here.)

Timeline for d6c12a2: