Lineage for d6c12a1 (6c12 A:1-235,A:356-450)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. Family c.3.1.4: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain [51934] (5 proteins)
  6. Protein Succinate dehydogenase [82311] (3 species)
  7. Species Escherichia coli [TaxId:83334] [349935] (1 PDB entry)
  8. Domain d6c12a1: 6c12 A:1-235,A:356-450 [350073]
    Other proteins in same PDB: d6c12a2, d6c12a3, d6c12b2, d6c12b3, d6c12c_, d6c12d_
    automated match to d1neka2
    complexed with fad, na

Details for d6c12a1

PDB Entry: 6c12 (more details), 2.15 Å

PDB Description: sdha-sdhe complex
PDB Compounds: (A:) Succinate dehydrogenase flavoprotein subunit

SCOPe Domain Sequences for d6c12a1:

Sequence, based on SEQRES records: (download)

>d6c12a1 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 83334]}
mklpvrefdavvigaggagmraalqisqsgqtcallskvfptrshtvsaqggitvalgnt
hednwewhmydtvkgsdyigdqdaieymcktgpeailelehmglpfsrlddgriyqrpfg
gqsknfggeqaartaaaadrtghallhtlyqqnlknhttifsewyaldlvknqdgavvgc
talcietgevvyfkaratvlatggagriyqsttnahintgdgvgmairagvpvqdXmmgg
iptkvtgqaltvnekgedvvvpglfavgeiacvsvhganrlggnslldlvvfgraaglhl
qesiaeqgalrdasesdveasldrlnrwnnn

Sequence, based on observed residues (ATOM records): (download)

>d6c12a1 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 83334]}
mklpvrefdavvigaggagmraalqisqsgqtcallskvfptrshtvsaqghmydtvkgs
dyigdqdaieymcktgpeailelehmglpfadrtghallhtlyqqnlknhttifsewyal
dlvknqdgavvgctalcietgevvyfkaratvlatggagriyqsttnahintgdgvgmai
ragvpvqdXmmggiptkvtgqaltvnekgedvvvpglfavgeiacvsvhganrlggnsll
dlvvfgraaglhlqesiaeqgalrdasesdveasldrlnrwnnn

SCOPe Domain Coordinates for d6c12a1 are not available.

Timeline for d6c12a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6c12a2, d6c12a3
View in 3D
Domains from other chains:
(mouse over for more information)
d6c12b1, d6c12b2, d6c12b3, d6c12c_, d6c12d_