Lineage for d6c9lf_ (6c9l F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963102Fold d.88: SRF-like [55454] (1 superfamily)
    alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet
  4. 2963103Superfamily d.88.1: SRF-like [55455] (2 families) (S)
  5. 2963104Family d.88.1.1: SRF-like [55456] (5 proteins)
  6. 2963117Protein Myocyte enhancer factor Mef2b core [103117] (1 species)
  7. 2963118Species Human (Homo sapiens) [TaxId:9606] [103118] (3 PDB entries)
    Uniprot Q02080 2-91
  8. 2963126Domain d6c9lf_: 6c9l F: [350067]
    automated match to d1tqep_

Details for d6c9lf_

PDB Entry: 6c9l (more details), 2.3 Å

PDB Description: mef2b apo protein structure
PDB Compounds: (F:) Myocyte-specific enhancer factor 2B

SCOPe Domain Sequences for d6c9lf_:

Sequence, based on SEQRES records: (download)

>d6c9lf_ d.88.1.1 (F:) Myocyte enhancer factor Mef2b core {Human (Homo sapiens) [TaxId: 9606]}
isrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyastdmdrvll
kyteysephesrtntdiletlk

Sequence, based on observed residues (ATOM records): (download)

>d6c9lf_ d.88.1.1 (F:) Myocyte enhancer factor Mef2b core {Human (Homo sapiens) [TaxId: 9606]}
isrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyastdmdrvll
kyteysetntdiletlk

SCOPe Domain Coordinates for d6c9lf_:

Click to download the PDB-style file with coordinates for d6c9lf_.
(The format of our PDB-style files is described here.)

Timeline for d6c9lf_: