Lineage for d6c6zl2 (6c6z L:107-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750273Domain d6c6zl2: 6c6z L:107-212 [350049]
    Other proteins in same PDB: d6c6zc_, d6c6zd1, d6c6zh_, d6c6zl1
    automated match to d1dn0a2
    complexed with nag

Details for d6c6zl2

PDB Entry: 6c6z (more details), 2.1 Å

PDB Description: crystal structure of potent neutralizing antibody cdc2-c2 in complex with mers-cov s1 rbd
PDB Compounds: (L:) Antibody CDC2-C2 light chain

SCOPe Domain Sequences for d6c6zl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c6zl2 b.1.1.2 (L:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d6c6zl2:

Click to download the PDB-style file with coordinates for d6c6zl2.
(The format of our PDB-style files is described here.)

Timeline for d6c6zl2: