Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (37 PDB entries) |
Domain d6c6xb1: 6c6x B:1-106 [350029] Other proteins in same PDB: d6c6xa2, d6c6xc2, d6c6xe2, d6c6xh2 automated match to d1dn0a1 |
PDB Entry: 6c6x (more details), 1.99 Å
SCOPe Domain Sequences for d6c6xb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6c6xb1 b.1.1.0 (B:1-106) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]} diqmtqspsslsasvgdrvtitcrasqdinnylswyqqkpgkapkpliyyassletgvps rfsgsrsgtdytltisslqledfatyycqqynnspysfgqgtkvei
Timeline for d6c6xb1: