SCOPe 2.08: Domain d6c09c2: 6c09 C:129-215

Lineage for d6c09c2 (6c09 C:129-215)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6c09c2: 6c09 C:129-215 [350022]
   Other proteins in same PDB: d6c09a1, d6c09a2, d6c09b_, d6c09c1, d6c09d1, d6c09d2
   automated match to d2f54d2
   complexed with d10, edo, ekg, k, nag, peg

Details for d6c09c2

PDB Entry: 6c09, 2.95 Å

PDB Description: ternary crystal structure of the 3c8 tcr-cd1c-monoacylglycerol complex

PDB Compounds: (C:) 3C8 T cell receptor alpha-chain

SCOPe Domain Sequences for d6c09c2:

Sequence, based on SEQRES records:

>d6c09c2 b.1.1.2 (C:129-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtff

Sequence, based on observed residues (ATOM records):

>d6c09c2 b.1.1.2 (C:129-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsacanafnnsiipedtff

Timeline for d6c09c2:

• d6c09c2 first appeared in SCOPe 2.07