SCOPe 2.08: Domain d6byff1: 6byf F:116-281

Lineage for d6byff1 (6byf F:116-281)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)

6. Protein automated matches [190696] (6 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [349828] (1 PDB entry)

8. Domain d6byff1: 6byf F:116-281 [350011]
   Other proteins in same PDB: d6byfa2, d6byfb2, d6byfc2, d6byfd2, d6byfe2, d6byff2, d6byfg2, d6byfh2, d6byfi2
   automated match to d1xria_
   complexed with cit, cl, edo

Details for d6byff1

PDB Entry: 6byf, 2.35 Å

PDB Description: crystal structure of the core catalytic domain of pp-ip phosphatase siw14 from s. cerevisiae in complex with citrate

PDB Compounds: (F:) Tyrosine-protein phosphatase SIW14

SCOPe Domain Sequences for d6byff1:

Sequence, based on SEQRES records:

>d6byff1 c.45.1.1 (F:116-281) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
vippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltgikl
yqvgmsgnkepfvnipshlltkaleivlnpanqpilihcnrgkhrtgcligcirklqnws
ltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw

Sequence, based on observed residues (ATOM records):

>d6byff1 c.45.1.1 (F:116-281) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
vippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltgikl
yqvgmsgvnipshlltkaleivlnpanqpilihcnrgkhrtgcligcirklqnwsltmif
deyrrfafpkaraldqqfiemydddeikriasknnwlplqw

Timeline for d6byff1:

• d6byff1 first appeared in SCOPe 2.07