Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.0: automated matches [191320] (1 protein) not a true family |
Protein automated matches [190116] (28 species) not a true protein |
Species Enterococcus faecalis [TaxId:226185] [349998] (1 PDB entry) |
Domain d6c8qd_: 6c8q D: [350002] automated match to d4q16a_ complexed with nad |
PDB Entry: 6c8q (more details), 2.58 Å
SCOPe Domain Sequences for d6c8qd_:
Sequence, based on SEQRES records: (download)
>d6c8qd_ c.26.2.0 (D:) automated matches {Enterococcus faecalis [TaxId: 226185]} ttlqekiiqelgvlptidpkeevrksidflkayltkhpflktfvlgisggqdstlagrla qlamtemreetgdmsyqfiairlpygeqadeadaqaalafiqpdvslrvdikpavdamvg slenagvqisdfnkgnmkarqrmitqyavagenagavigtdhaaenvtafftkygdggad ilplfrlnkrqgkallkelgapealylkiptadleddkplvadevalgvtydaiddyleg kkvsetdqqtienwykkgqhkrhlpitifddfwk
>d6c8qd_ c.26.2.0 (D:) automated matches {Enterococcus faecalis [TaxId: 226185]} ttlqekiiqelgvlptidpkeevrksidflkayltkhpflktfvlgisggqdstlagrla qlamtemreetgdmsyqfiairlpygeqadeadaqaalafiqpdvslrvdikpavdamvg slenagvqisdfnkgnmkarqrmitqyavagenagavigtdhaaenvtafftkygdggad ilplfrlnkrqgkallkelgapealylkplvadevalgvtydaiddylegkkvsetdqqt ienwykkgqhkrhlpitifddfwk
Timeline for d6c8qd_: