Lineage for d6br6a_ (6br6 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2398193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2398194Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2398195Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 2398208Protein Influenza neuraminidase [50943] (6 species)
  7. 2398224Species Influenza A virus, different strains [TaxId:11320] [50944] (89 PDB entries)
    Uniprot P03472 84-470
  8. 3049916Domain d6br6a_: 6br6 A: [349978]
    automated match to d2aepa1
    complexed with bma, ca, e3m, gol, man, nag, ni

Details for d6br6a_

PDB Entry: 6br6 (more details), 2.04 Å

PDB Description: n2 neuraminidase in complex with a novel antiviral compound
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d6br6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6br6a_ b.68.1.1 (A:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
eyrnwskpqcditgfapfskdnsirlsaggdiwvtrepyvscdpdkcyqfalgqgttlnn
vhsnntvrdrtpyrtllmnelgvpfhlgtkqvciawsssschdgkawlhvcitgddknat
asfiyngrlvdsvvswskeilrtqesecvcingtctvvmtdgsasgkadtkilfieegki
vhtstlsgsaqhveecscyprypgvrcvcrdnwkgsnrpivdinikdhsivssyvcsglv
gdtprkndssssshcldpnneegghgvkgwafddgndvwmgrtiseksrlgyetfkvieg
wsnpksklqinrqvivdrgnrsgysgifsvegkscinrcfyvelirgrkeetevlwtsns
ivvfcgtsgtygtgswpdgadinlmpi

SCOPe Domain Coordinates for d6br6a_:

Click to download the PDB-style file with coordinates for d6br6a_.
(The format of our PDB-style files is described here.)

Timeline for d6br6a_:

  • d6br6a_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-07