Lineage for d6c6bb_ (6c6b B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474612Family c.37.1.4: Adenosine-5'phosphosulfate kinase (APS kinase) [52572] (2 proteins)
    automatically mapped to Pfam PF01583
  6. 2474632Protein automated matches [226942] (4 species)
    not a true protein
  7. 2474633Species Cryptococcus neoformans [TaxId:235443] [349971] (1 PDB entry)
  8. 2474635Domain d6c6bb_: 6c6b B: [349977]
    automated match to d1m7ga_
    complexed with adp, edo

Details for d6c6bb_

PDB Entry: 6c6b (more details), 2 Å

PDB Description: co-crystal structure of adenylyl-sulfate kinase from cryptococcus neoformans bound to adp
PDB Compounds: (B:) Adenylyl-sulfate kinase

SCOPe Domain Sequences for d6c6bb_:

Sequence, based on SEQRES records: (download)

>d6c6bb_ c.37.1.4 (B:) automated matches {Cryptococcus neoformans [TaxId: 235443]}
atnitfhpgavtqderdtllgqkgctvwltglsasgkstiataleqhllhkklhayrldg
dnirfglnkdlgfdqasrvenirrigevsllfalsstisvtafispyisdrqlarelhek
hssaipfievfidaplsvveqrdpkglykkarageikdftgisapyeapanpeihirtde
vdvagaveiitkyladnglipa

Sequence, based on observed residues (ATOM records): (download)

>d6c6bb_ c.37.1.4 (B:) automated matches {Cryptococcus neoformans [TaxId: 235443]}
atnitfhpgavtqderdtllgqkgctvwltglsasgkstiataleqhllhkklhayrldg
dnirfglnkdlgfdqasrvenirrigevsllfalsstisvtafispyisdrqlarelhek
hssaipfievfidaplsvveqrdpkglykkaeikdftgisapyeapanpeihirtdevdv
agaveiitkyladnglipa

SCOPe Domain Coordinates for d6c6bb_:

Click to download the PDB-style file with coordinates for d6c6bb_.
(The format of our PDB-style files is described here.)

Timeline for d6c6bb_: