Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.4: Adenosine-5'phosphosulfate kinase (APS kinase) [52572] (2 proteins) automatically mapped to Pfam PF01583 |
Protein automated matches [226942] (4 species) not a true protein |
Species Cryptococcus neoformans [TaxId:235443] [349971] (1 PDB entry) |
Domain d6c6be_: 6c6b E: [349972] automated match to d1m7ga_ complexed with adp, edo |
PDB Entry: 6c6b (more details), 2 Å
SCOPe Domain Sequences for d6c6be_:
Sequence, based on SEQRES records: (download)
>d6c6be_ c.37.1.4 (E:) automated matches {Cryptococcus neoformans [TaxId: 235443]} hpgavtqderdtllgqkgctvwltglsasgkstiataleqhllhkklhayrldgdnirfg lnkdlgfdqasrvenirrigevsllfalsstisvtafispyisdrqlarelhekhssaip fievfidaplsvveqrdpkglykkarageikdftgisapyeapanpeihirtdevdvaga veiitkyladnglip
>d6c6be_ c.37.1.4 (E:) automated matches {Cryptococcus neoformans [TaxId: 235443]} hpgavtqderdtllgqkgctvwltglsasgkstiataleqhllhkklhayrldgdnirfg lnkdlgfdqasrvenirrigevsllfalsstisvtafispyisdrqlarelhekhssaip fievfidaplsvveqrdpkglykkaeikdftgisapyeapanpeihirtdevdvagavei itkyladnglip
Timeline for d6c6be_: