Lineage for d1alib_ (1ali B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27200Fold c.76: Phosphatase/sulphatase [53648] (1 superfamily)
  4. 27201Superfamily c.76.1: Phosphatase/sulphatase [53649] (2 families) (S)
  5. 27202Family c.76.1.1: Alkaline phosphatase [53650] (1 protein)
  6. 27203Protein Alkaline phosphatase [53651] (1 species)
  7. 27204Species Escherichia coli [TaxId:562] [53652] (21 PDB entries)
  8. 27214Domain d1alib_: 1ali B: [34997]

Details for d1alib_

PDB Entry: 1ali (more details), 2.2 Å

PDB Description: alkaline phosphatase mutant (h412n)

SCOP Domain Sequences for d1alib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1alib_ c.76.1.1 (B:) Alkaline phosphatase {Escherichia coli}
mpvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaarn
yaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngalgvd
ihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpgnal
ekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaasl
nsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmt
dkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkegntl
vivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqentgsqlriaayg
phaanvvgltdqtdlfytmkaalglk

SCOP Domain Coordinates for d1alib_:

Click to download the PDB-style file with coordinates for d1alib_.
(The format of our PDB-style files is described here.)

Timeline for d1alib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1alia_