Lineage for d6bnla2 (6bnl A:186-278)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760446Domain d6bnla2: 6bnl A:186-278 [349969]
    Other proteins in same PDB: d6bnla1, d6bnlb_, d6bnlc2, d6bnle1, d6bnlf_, d6bnlg2
    automated match to d1zt4c1
    complexed with nag, qwv

Details for d6bnla2

PDB Entry: 6bnl (more details), 2.6 Å

PDB Description: crystal structure of tcr-mhc-like molecule
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d6bnla2:

Sequence, based on SEQRES records: (download)

>d6bnla2 b.1.1.0 (A:186-278) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiily

Sequence, based on observed residues (ATOM records): (download)

>d6bnla2 b.1.1.0 (A:186-278) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqatllac
rvkhsslggqdiily

SCOPe Domain Coordinates for d6bnla2:

Click to download the PDB-style file with coordinates for d6bnla2.
(The format of our PDB-style files is described here.)

Timeline for d6bnla2: