| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d6bnla2: 6bnl A:186-278 [349969] Other proteins in same PDB: d6bnla1, d6bnlb_, d6bnlc2, d6bnle1, d6bnlf_, d6bnlg2 automated match to d1zt4c1 complexed with nag, qwv |
PDB Entry: 6bnl (more details), 2.6 Å
SCOPe Domain Sequences for d6bnla2:
Sequence, based on SEQRES records: (download)
>d6bnla2 b.1.1.0 (A:186-278) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiily
>d6bnla2 b.1.1.0 (A:186-278) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqatllac
rvkhsslggqdiily
Timeline for d6bnla2: