SCOPe 2.08: Domain d6bnla2: 6bnl A:186-278

Lineage for d6bnla2 (6bnl A:186-278)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d6bnla2: 6bnl A:186-278 [349969]
   Other proteins in same PDB: d6bnla1, d6bnlb_, d6bnlc2, d6bnle1, d6bnlf_, d6bnlg2
   automated match to d1zt4c1
   complexed with nag, qwv

Details for d6bnla2

PDB Entry: 6bnl, 2.6 Å

PDB Description: crystal structure of tcr-mhc-like molecule

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d6bnla2:

Sequence, based on SEQRES records:

>d6bnla2 b.1.1.0 (A:186-278) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiily

Sequence, based on observed residues (ATOM records):

>d6bnla2 b.1.1.0 (A:186-278) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqatllac
rvkhsslggqdiily

Timeline for d6bnla2:

• d6bnla2 first appeared in SCOPe 2.07