Lineage for d6c12d_ (6c12 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737726Fold a.218: YgfY-like [109909] (1 superfamily)
    5 helices; array; forms a tight dimer in crystals
  4. 2737727Superfamily a.218.1: YgfY-like [109910] (2 families) (S)
  5. 2737732Family a.218.1.0: automated matches [254244] (1 protein)
    not a true family
  6. 2737733Protein automated matches [254560] (3 species)
    not a true protein
  7. 2737740Species Escherichia coli [TaxId:83334] [349942] (1 PDB entry)
  8. 2737742Domain d6c12d_: 6c12 D: [349967]
    Other proteins in same PDB: d6c12a1, d6c12a2, d6c12a3, d6c12b1, d6c12b2, d6c12b3
    automated match to d1x6ib_
    complexed with fad, na

Details for d6c12d_

PDB Entry: 6c12 (more details), 2.15 Å

PDB Description: sdha-sdhe complex
PDB Compounds: (D:) FAD assembly factor SdhE

SCOPe Domain Sequences for d6c12d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c12d_ a.218.1.0 (D:) automated matches {Escherichia coli [TaxId: 83334]}
dinnkarihwacrrgmreldisimpffeheydslsddekrifirllecddpdlfnwlmnh
gkpadaelemmvrliqtrnrergpva

SCOPe Domain Coordinates for d6c12d_:

Click to download the PDB-style file with coordinates for d6c12d_.
(The format of our PDB-style files is described here.)

Timeline for d6c12d_: