![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.218: YgfY-like [109909] (1 superfamily) 5 helices; array; forms a tight dimer in crystals |
![]() | Superfamily a.218.1: YgfY-like [109910] (2 families) ![]() |
![]() | Family a.218.1.0: automated matches [254244] (1 protein) not a true family |
![]() | Protein automated matches [254560] (3 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83334] [349942] (1 PDB entry) |
![]() | Domain d6c12c_: 6c12 C: [349943] Other proteins in same PDB: d6c12a1, d6c12a2, d6c12a3, d6c12b1, d6c12b2, d6c12b3 automated match to d1x6ib_ complexed with fad, na |
PDB Entry: 6c12 (more details), 2.15 Å
SCOPe Domain Sequences for d6c12c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6c12c_ a.218.1.0 (C:) automated matches {Escherichia coli [TaxId: 83334]} dinnkarihwacrrgmreldisimpffeheydslsddekrifirllecddpdlfnwlmnh gkpadaelemmvrliqtrnrergpv
Timeline for d6c12c_: