Lineage for d6c12b3 (6c12 B:451-583)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696597Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 2696598Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 2696637Protein Succinate dehydogenase [81708] (3 species)
  7. 2696656Species Escherichia coli [TaxId:83334] [349940] (1 PDB entry)
  8. 2696658Domain d6c12b3: 6c12 B:451-583 [349941]
    Other proteins in same PDB: d6c12a1, d6c12a2, d6c12b1, d6c12b2, d6c12c_, d6c12d_
    automated match to d1neka1
    complexed with fad, na

Details for d6c12b3

PDB Entry: 6c12 (more details), 2.15 Å

PDB Description: sdha-sdhe complex
PDB Compounds: (B:) Succinate dehydrogenase flavoprotein subunit

SCOPe Domain Sequences for d6c12b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c12b3 a.7.3.1 (B:451-583) Succinate dehydogenase {Escherichia coli [TaxId: 83334]}
rngedpvairkalqecmqhnfsvfregdamakgleqlkvirerlknarlddtssefntqr
vecleldnlmetayatavsanfrtesrgahsrfdfpdrddenwlchslylpesesmtrrs
vnmepklrpafpp

SCOPe Domain Coordinates for d6c12b3:

Click to download the PDB-style file with coordinates for d6c12b3.
(The format of our PDB-style files is described here.)

Timeline for d6c12b3: