SCOPe 2.07: Domain d6b3ed1: 6b3e D:21-157

Lineage for d6b3ed1 (6b3e D:21-157)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein automated matches [227027] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225840] (19 PDB entries)

8. Domain d6b3ed1: 6b3e D:21-157 [349926]
   Other proteins in same PDB: d6b3ea_, d6b3ec_
   automated match to d2i53a1
   complexed with cjm, edo, mg

Details for d6b3ed1

PDB Entry: 6b3e, 3.06 Å

PDB Description: crystal structure of human cdk12/cyclink in complex with an inhibitor

PDB Compounds: (D:) cyclin-k

SCOPe Domain Sequences for d6b3ed1:

Sequence; same for both SEQRES and ATOM records:

>d6b3ed1 a.74.1.1 (D:21-157) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhydtlatgiiyfhr
fymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvqfgqfgddpkeev
mvlerillqtikfdlqv

Timeline for d6b3ed1:

• d6b3ed1 is new in SCOPe 2.07-stable
  
• d6b3ed1 appears in the current release, SCOPe 2.08