Lineage for d1ed8b_ (1ed8 B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 74262Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
  4. 74263Superfamily c.76.1: Alkaline phosphatase-like [53649] (3 families) (S)
  5. 74264Family c.76.1.1: Alkaline phosphatase [53650] (1 protein)
  6. 74265Protein Alkaline phosphatase [53651] (2 species)
  7. 74266Species Escherichia coli [TaxId:562] [53652] (21 PDB entries)
  8. 74268Domain d1ed8b_: 1ed8 B: [34989]

Details for d1ed8b_

PDB Entry: 1ed8 (more details), 1.75 Å

PDB Description: structure of e. coli alkaline phosphatase inhibited by the inorganic phosphate at 1.75a resolution

SCOP Domain Sequences for d1ed8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ed8b_ c.76.1.1 (B:) Alkaline phosphatase {Escherichia coli}
tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
gvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpg
nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
aygphaanvvgltdqtdlfytmkaalglk

SCOP Domain Coordinates for d1ed8b_:

Click to download the PDB-style file with coordinates for d1ed8b_.
(The format of our PDB-style files is described here.)

Timeline for d1ed8b_: