Lineage for d6bmxa3 (6bmx A:219-525)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2454571Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2454572Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2454684Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 2454892Protein automated matches [190252] (5 species)
    not a true protein
  7. 2454893Species Human (Homo sapiens) [TaxId:9606] [187034] (47 PDB entries)
  8. 3049825Domain d6bmxa3: 6bmx A:219-525 [349887]
    Other proteins in same PDB: d6bmxa1, d6bmxa2, d6bmxb1, d6bmxb2
    automated match to d2shpa1
    complexed with dyv, gol, po4

Details for d6bmxa3

PDB Entry: 6bmx (more details), 2.42 Å

PDB Description: non-receptor protein tyrosine phosphatase shp2 in complex with allosteric inhibitor shp844
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d6bmxa3:

Sequence, based on SEQRES records: (download)

>d6bmxa3 c.45.1.2 (A:219-525) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trinaaeiesrvrelsklaettdkvkqgfweefetlqqqeckllysrkegqrqenknknr
yknilpfdhtrvvlhdgdpnepvsdyinaniimpefetkcnnskpkksyiatqgclqntv
ndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytl
relklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvh
csagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymav
qhyietl

Sequence, based on observed residues (ATOM records): (download)

>d6bmxa3 c.45.1.2 (A:219-525) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trinaaeiesrvrelsklqgfweefetlqqqeckllysrkegqrqenknknryknilpfd
htrvvlhdgdppvsdyinaniimpeksyiatqgclqntvndfwrmvfqensrvivmttke
vergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyh
frtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidii
rekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietl

SCOPe Domain Coordinates for d6bmxa3:

Click to download the PDB-style file with coordinates for d6bmxa3.
(The format of our PDB-style files is described here.)

Timeline for d6bmxa3:

  • d6bmxa3 is new in SCOPe 2.07-stable