Lineage for d6bx4d_ (6bx4 D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2358952Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2359497Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2359498Protein automated matches [190976] (4 species)
    not a true protein
  7. 2359522Species Human (Homo sapiens) [TaxId:9606] [188649] (64 PDB entries)
  8. 3049821Domain d6bx4d_: 6bx4 D: [349883]
    automated match to d5kbnc_
    complexed with dmu, f, na

Details for d6bx4d_

PDB Entry: 6bx4 (more details), 2.55 Å

PDB Description: the crystal structure of fluoride channel fluc ec2 with monobody s9
PDB Compounds: (D:) monobody

SCOPe Domain Sequences for d6bx4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bx4d_ b.1.2.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svssvptklevvaatptslliswdapavtvvhyvitygetggnspvqeftvpgskstati
sglkpgvdytitvytmyysysdlysysspisinyrt

SCOPe Domain Coordinates for d6bx4d_:

Click to download the PDB-style file with coordinates for d6bx4d_.
(The format of our PDB-style files is described here.)

Timeline for d6bx4d_:

  • d6bx4d_ is new in SCOPe 2.07-stable