![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
![]() | Protein automated matches [227017] (58 species) not a true protein |
![]() | Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [327808] (18 PDB entries) |
![]() | Domain d6bkqa1: 6bkq A:11-329 [349880] Other proteins in same PDB: d6bkqa2, d6bkqb_, d6bkqc2, d6bkqd_, d6bkqe2, d6bkqf_ automated match to d4xkga_ complexed with nag, tam; mutant |
PDB Entry: 6bkq (more details), 2.25 Å
SCOPe Domain Sequences for d6bkqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bkqa1 b.19.1.0 (A:11-329) automated matches {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]} atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv tqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstnqd qtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsngn liaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpkyvk qntlklatgmrnvpekqtr
Timeline for d6bkqa1: