SCOPe 2.08: Domain d6bkqa1: 6bkq A:11-329

Lineage for d6bkqa1 (6bkq A:11-329)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (58 species)
   not a true protein

7. Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [327808] (18 PDB entries)

8. Domain d6bkqa1: 6bkq A:11-329 [349880]
   Other proteins in same PDB: d6bkqa2, d6bkqb_, d6bkqc2, d6bkqd_, d6bkqe2, d6bkqf_
   automated match to d4xkga_
   complexed with nag, tam; mutant

Details for d6bkqa1

PDB Entry: 6bkq, 2.25 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin e190d mutant in complex with 6'-sln

PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6bkqa1:

Sequence; same for both SEQRES and ATOM records:

>d6bkqa1 b.19.1.0 (A:11-329) automated matches {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal
lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv
tqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstnqd
qtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsngn
liaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpkyvk
qntlklatgmrnvpekqtr

Timeline for d6bkqa1:

• d6bkqa1 first appeared in SCOPe 2.07