![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein T-cell antigen receptor [49125] (7 species) |
![]() | Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (46 PDB entries) |
![]() | Domain d6bnlg2: 6bnl G:118-206 [349867] Other proteins in same PDB: d6bnla1, d6bnla2, d6bnlb_, d6bnlc1, d6bnld1, d6bnld2, d6bnle1, d6bnle2, d6bnlf_, d6bnlg1, d6bnlh1, d6bnlh2 automated match to d4eura2 complexed with nag, qwv |
PDB Entry: 6bnl (more details), 2.6 Å
SCOPe Domain Sequences for d6bnlg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bnlg2 b.1.1.2 (G:118-206) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffps
Timeline for d6bnlg2: