SCOPe 2.08: Domain d6bnlg1: 6bnl G:1-117

Lineage for d6bnlg1 (6bnl G:1-117)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6bnlg1: 6bnl G:1-117 [349866]
   Other proteins in same PDB: d6bnla1, d6bnlb_, d6bnlc2, d6bnle1, d6bnlf_, d6bnlg2
   automated match to d4eura1
   complexed with nag, qwv

Details for d6bnlg1

PDB Entry: 6bnl, 2.6 Å

PDB Description: crystal structure of tcr-mhc-like molecule

PDB Compounds: (G:) NKT Valpha14 (MOUSE) - 2C12 TCR - Hybrid mouse variable and human constant domains

SCOPe Domain Sequences for d6bnlg1:

Sequence; same for both SEQRES and ATOM records:

>d6bnlg1 b.1.1.0 (G:1-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqveqspqslvvrqgensvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

Timeline for d6bnlg1:

• d6bnlg1 first appeared in SCOPe 2.07