Lineage for d1cjya2 (1cjy A:142-721)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27193Fold c.75: Cytosolic phospholipase A2 catalytic domain [53643] (1 superfamily)
  4. 27194Superfamily c.75.1: Cytosolic phospholipase A2 catalytic domain [53644] (1 family) (S)
  5. 27195Family c.75.1.1: Cytosolic phospholipase A2 catalytic domain [53645] (1 protein)
  6. 27196Protein Cytosolic phospholipase A2 catalytic domain [53646] (1 species)
  7. 27197Species Human (Homo sapiens) [TaxId:9606] [53647] (1 PDB entry)
  8. 27198Domain d1cjya2: 1cjy A:142-721 [34986]
    Other proteins in same PDB: d1cjya1, d1cjyb1

Details for d1cjya2

PDB Entry: 1cjy (more details), 2.5 Å

PDB Description: human cytosolic phospholipase a2

SCOP Domain Sequences for d1cjya2:

Sequence, based on SEQRES records: (download)

>d1cjya2 c.75.1.1 (A:142-721) Cytosolic phospholipase A2 catalytic domain {Human (Homo sapiens)}
pdlrfsmalcdqektfrqqrkehiresmkkllgpknseglhsardvpvvailgsgggfra
mvgfsgvmkalyesgildcatyvaglsgstwymstlyshpdfpekgpeeineelmknvsh
nplllltpqkvkryveslwkkkssgqpvtftdifgmligetlihnrmnttlsslkekvnt
aqcplplftclhvkpdvselmfadwvefspyeigmakygtfmapdlfgskffmgtvvkky
eenplhflmgvwgsafsilfnrvlgvsgsqsrgstmeeelenittkhivsndssdsddes
hepkgtenedagsdyqsdnqaswihrmimalvsdsalfntregragkvhnfmlglnlnts
yplsplsdfatqdsfdddeldaavadpdeferiyepldvkskkihvvdsgltfnlpypli
lrpqrgvdliisfdfsarpsdssppfkelllaekwakmnklpfpkidpyvfdreglkecy
vfkpknpdmekdcptiihfvlaninfrkykapgvpreteeekeiadfdifddpespfstf
nfqypnqafkrlhdlmhfntlnnidvikeamvesieyrrq

Sequence, based on observed residues (ATOM records): (download)

>d1cjya2 c.75.1.1 (A:142-721) Cytosolic phospholipase A2 catalytic domain {Human (Homo sapiens)}
pdlrfsmalcdqektfrqqrkehiresmkkllgpknseglhsardvpvvailgsgggfra
mvgfsgvmkalyesgildcatyvaglsgstwymstlyshpdfpekgpeeineelmknvsh
nplllltpqkvkryveslwkkkssgqpvtftdifgmligetlihnrmnttlsslkekvnt
aqcplplftclhvkpdvselmfadwvefspyeigmakygtfmapdlfgskffmgtvvkky
eenplhflmgvwgsafsilfnrvlstmeeelenittkhivsnnqaswihrmimalvsdsa
lfntregragkvhnfmlglnldvkskkihvvdsgltfnlpyplilrpqrgvdliisfdfs
arpsdssppfkelllaekwakmnklpfpkidpyvfdreglkecyvfkpknpdmekdcpti
ihfvlaninfrkykapgvpreteeekeiadfdifddpespfstfnfqypnqafkrlhdlm
hfntlnnidvikeamvesieyrrq

SCOP Domain Coordinates for d1cjya2:

Click to download the PDB-style file with coordinates for d1cjya2.
(The format of our PDB-style files is described here.)

Timeline for d1cjya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cjya1