Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.0: automated matches [227172] (1 protein) not a true family |
Protein automated matches [226887] (24 species) not a true protein |
Species Cryptosporidium parvum [TaxId:353152] [326196] (5 PDB entries) |
Domain d6bnia2: 6bni A:194-545 [349853] Other proteins in same PDB: d6bnia1, d6bnia3, d6bnib1, d6bnib3 automated match to d5elna2 protein/RNA complex; complexed with adn, edo, lys, na, so4 |
PDB Entry: 6bni (more details), 1.85 Å
SCOPe Domain Sequences for d6bnia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bnia2 d.104.1.0 (A:194-545) automated matches {Cryptosporidium parvum [TaxId: 353152]} dqevryrqryldlmlneesrkvfklrsraikyirnyfdrlgflevetpmlnmiyggaaar pfityhneletqlymriapelylkqlivggldkvyeigknfrnegidlthnpeftamefy mayadyydlmdlteelisglvleihgslkipyhpdgpegkcieidfttpwkrfsfveeie sglgeklkrpldsqenidfmvemcekheielphprtaaklldklaghfvetkctnpsfii dhpqtmsplakwhrekpemterfelfvlgkelcnaytelneplqqrkffeqqadakasgd veacpidetfclalehglpptggwglgidrlimfladknnikevilfpamrn
Timeline for d6bnia2: