Lineage for d1e46p_ (1e46 P:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905490Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily)
    3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5
  4. 2905491Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (3 families) (S)
  5. 2905492Family c.74.1.1: AraD-like aldolase/epimerase [53640] (5 proteins)
    metal (zinc)-ion dependent
  6. 2905493Protein L-fuculose-1-phosphate aldolase [53641] (1 species)
    class II aldolase
  7. 2905494Species Escherichia coli [TaxId:562] [53642] (17 PDB entries)
  8. 2905511Domain d1e46p_: 1e46 P: [34984]
    complexed with bme, so4, zn; mutant

Details for d1e46p_

PDB Entry: 1e46 (more details), 2.55 Å

PDB Description: l-fuculose 1-phosphate aldolase from escherichia coli mutant e73s
PDB Compounds: (P:) l-fuculose 1-phosphate aldolase

SCOPe Domain Sequences for d1e46p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e46p_ c.74.1.1 (P:) L-fuculose-1-phosphate aldolase {Escherichia coli [TaxId: 562]}
mernklarqiidtclemtrlglnqgtagnvsvryqdgmlitptgipyeklteshivfidg
ngkheegklpssswrfhmaayqsrpdanavvhnhavhctavsilnrsipaihymiaaagg
nsipcapyatfgtrelsehvalalknrkatllqhhgliacevnlekalwlahevevlaql
ylttlaitdpvpvlsdeeiavvlekf

SCOPe Domain Coordinates for d1e46p_:

Click to download the PDB-style file with coordinates for d1e46p_.
(The format of our PDB-style files is described here.)

Timeline for d1e46p_: