Lineage for d6bx5d_ (6bx5 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2762239Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2762240Protein automated matches [190976] (5 species)
    not a true protein
  7. 2762264Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)
  8. 2762382Domain d6bx5d_: 6bx5 D: [349836]
    automated match to d3uyod_
    complexed with f, na

Details for d6bx5d_

PDB Entry: 6bx5 (more details), 3 Å

PDB Description: the crystal structure of fluoride channel fluc ec2 with monobody s12
PDB Compounds: (D:) Monobody S12

SCOPe Domain Sequences for d6bx5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bx5d_ b.1.2.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssvptklevvaatptslliswdapavtvifyvitygetggnspvqeftvpgskstatisg
lkpgvdytitvyatyyasnsgwyeygspisinyrt

SCOPe Domain Coordinates for d6bx5d_:

Click to download the PDB-style file with coordinates for d6bx5d_.
(The format of our PDB-style files is described here.)

Timeline for d6bx5d_: